SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909389|ref|YP_323685.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909389|ref|YP_323685.1|
Domain Number 1 Region: 3-79,174-343
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.08e-46
Family Bacterial dinuclear zinc exopeptidases 0.0048
Further Details:      
 
Domain Number 2 Region: 73-187
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.0000000000000687
Family Aminopeptidase/glucanase lid domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909389|ref|YP_323685.1|
Sequence length 346
Comment peptidases M20 and M42 [Anabaena variabilis ATCC 29413]
Sequence
MCNYNQLFENIAELVMHHSPSGAEAEINQLLLQKFAALGVEVWSDRADNIIAKIPGKNSE
RAVAITAHKDEIGAIVKNIGDAGKVEVRKLGGAYPWVYGEGVVDLLGDNETISGILSFGS
RHVSHESPQKVQQEDTAVKWENAWIETKRTTEELEIAGIRPGTRMVIGKHRKHPVKLQDH
IASYTLDNKASVAILLALAQQLKQPAMDVYLVASAKEEVGAIGALFFTQNQQLDALIALE
ICPLSEEYPVKDSENPVLLIQDAYGIYDEGLNGELRQCAKQLNMPVQLTTLSGFGSDASI
AMKFGHVGRAACLAFPTQNTHGYEIAHLGAISNCINLLKAFCETEF
Download sequence
Identical sequences A0A1W5CQK7 Q3M896
gi|75909389|ref|YP_323685.1| 375065 240292.Ava_3182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]