SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909397|ref|YP_323693.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909397|ref|YP_323693.1|
Domain Number 1 Region: 168-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.03e-73
Family Extended AAA-ATPase domain 0.0000000319
Further Details:      
 
Domain Number 2 Region: 423-618
Classification Level Classification E-value
Superfamily FtsH protease domain-like 8.89e-72
Family FtsH protease domain-like 0.00000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909397|ref|YP_323693.1|
Sequence length 628
Comment FtsH peptidase [Anabaena variabilis ATCC 29413]
Sequence
MKFSWRVLVLWTLPALVIGFFFWQGTFAGAPADMSKNAANTRMTYGRFLEYVDAGRVTSV
DLYEGGRTAIVEAQDQDIENRVQRWRVDLPVSAPELISKLKEKKVSFDAHPARNDGAIWG
LLGNLVFPILLITGLFFLFRRSNNLPGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEE
AKEELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGS
EFVEMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGNDEREQTLNQLL
TEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLQVHARNKK
LDPSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITLSEIDDAVDRVVAGMEGT
PLVDSKSKRLIAYHEVGHALVGTLLKDHDPVQKVTLIPRGQAQGLTWFTPNEEQGLISRS
QLKARITGALGGRAAEEIIFGSAEVTTGAGGDLQQVSGMARQMVTRFGMSDLGPLSLESQ
QGEVFLGRDWMTRSDYSESIAARIDSQVRLIVDECYENAKKIMRDHRTVTDRIVDLLIEK
ETIDGDEFRQIVAEYTDVPDKQQFVPQL
Download sequence
Identical sequences A0A1W5CQY0 Q3M888
gi|75909397|ref|YP_323693.1| 240292.Ava_3190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]