SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909432|ref|YP_323728.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909432|ref|YP_323728.1|
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 1.33e-35
Family DHN aldolase/epimerase 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909432|ref|YP_323728.1|
Sequence length 121
Comment dihydroneopterin aldolase family protein [Anabaena variabilis ATCC 29413]
Sequence
MDCIHLTEIRCYGYTGYLPEEQVLGQWFEVDVKLWLDLSAAAKSDEIADTLDYRSVISLI
KDLVKTSKFALIERLAGAIADSIIQQCHQVAQVQVKLTKPAAPIPDFGGKISIDLTKTRT
T
Download sequence
Identical sequences A0A1W5CQR7 Q3M853
gi|75909432|ref|YP_323728.1| 240292.Ava_3225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]