SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909434|ref|YP_323730.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909434|ref|YP_323730.1|
Domain Number 1 Region: 104-318
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.77e-59
Family BC ATP-binding domain-like 0.00000513
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.01e-35
Family BC N-terminal domain-like 0.000044
Further Details:      
 
Domain Number 3 Region: 329-423
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.02e-31
Family BC C-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909434|ref|YP_323730.1|
Sequence length 425
Comment phosphoribosylamine--glycine ligase [Anabaena variabilis ATCC 29413]
Sequence
MKVLVVGNGGREHALAWKLLQSPQIEQVACVPGNGGTATLARCQNVALAVDDFEGISQYA
LNQGFSLVVVGPEVPLAKGITDYLQEKGLMVFGPSRAGAQIEASKAWAKALMQEAGIPTA
KAAVFTEAAAAKSYIQAQGAPIVVKADGLAAGKGVTVATTIEQAQSAIDAIFQGQFGSAG
EFVVIEECLTGQEVSVLALTDGLTIRPLLPAQDHKRIGEGDTGENTGGMGAYAPAPIATP
ELMARVQTEVLERAIATLQSKGIDYRGVLYAGLMITPNGDFKVLEFNCRFGDPETQVILP
LLATPLEELILACVQQRLGELPPIAWQGGASATVVAASGGYPGDYEKGQVITGIPQAEAT
GATVFHAGTKLNAQQQIVTDGGRVLNVTGIGENFQQALAQAYTGIKAIDFSGIYYRRDIG
YRVNS
Download sequence
Identical sequences A0A1W5CQZ3 Q3M851
gi|75909434|ref|YP_323730.1| 240292.Ava_3227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]