SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909458|ref|YP_323754.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75909458|ref|YP_323754.1|
Domain Number - Region: 275-363
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000241
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 1288-1330
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.0144
Family N-utilization substance G protein NusG, N-terminal domain 0.014
Further Details:      
 
Domain Number - Region: 63-234
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0628
Family HBL-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909458|ref|YP_323754.1|
Sequence length 1374
Comment chromosome segregation ATPase-like protein [Anabaena variabilis ATCC 29413]
Sequence
MMINRLILGAISFGVGFGISLALERDVKRAALTGLITIPATSLGILVTDNHCRKQLNEHL
LPVQSRVAALEKQVEKLKKQKAALEKAIIASQENKQQVETSFESLQIELSQLQDLLLTQQ
NEKTSTEQELVDLETQRQQLTAESHHLQTRNEELKQQELTLKQSLEAIATQKQQLETDCN
SLQGRLSQLQANISNQQHNEQEQADLIAQKHLLETDIQTLYTQIHHLRQQETELNQSLES
LITQKQQTNESFNQQLQKLKQLQNQISEQEDYHAKLSENLDALEQQKHQLEIDLSNLKLQ
INSLESQLNGLNQSVTSLTTQQQEAQLNLNSLQTNLIQLQQDKEQLIQELASLTARKEAS
QRNLSQPQLNQPVTKEGSPSSVTYAKAEGLPNKTAPIKAQISSHQRQSRSSGGTTFMNPR
YTQNLWEEQILPHWSHRDRPVGRRFLGSIKMTRNTSEQILDIVGQNLQQLDRVTYDSLQN
EFYELEQNWLKILTVALSEYAYYYSSERFWQGFCDRLDINHNQGVENTFRQIVDEGINIL
GLVRAKGGYKYVSTLWLQSGVPEQNLEHFAQLVQEIADEYGWWELAHTQPEELAQLLLNV
CDAKYSQWGTLINFLKSSCSEDAHTEPVSGQLLQGIAIVAQELERQKARPQVLADEEQRE
KILGNYYLPQNFFLRNWDALTQVLTPKSGSGRSRSIITRRSKPLLLSLDVEDSLNTQLLL
PEQVLWKPEWRNLRDTYCQIPQGNWEDIIPTNGDLSIPELIIEVNQALENWNCQLVDHNR
QNLMEWNYKGINSNLPCLVFDALTGEHLPLDYFQPRITSVEEVYCFTPKDIQPEFTNGIE
ILDSYIPSSIRGWRGRHIRLIAPESSIVLTIPETHQNQLIIWKLLRDDEPVFTGLKLTGK
KAIYLGTPTFWYPPVNQNLNMNVLVEDITKQSIIARTIETLSPNNQWIAIKLSQWITTPG
YYEARFWFDEKRWSYRFEVRSKHQTSAIAPLNQLRISSNSGISETDLPIKHEHSDKFWSE
VIKIDGLWPLEEIIFFVSNESEKIQQSIQADASGNLTVNLSTLHELLPNSEWYALDYQRL
GLEAQRLVEMQGLPHNITWSWTSNSINLSGLHPDKFYSLLCWNLLLPDSEAEEIKIPLIN
HDENTIEVPLNLSTGIYYIQLVSPQLLPEELGWWCGSGKNDLPNNLNEDRENYCYTVLGN
SESKESFIEAVNRLNLDIDSQQLQTRIIALENNKYYFPDWLSKDILITKLKALLNLLSVA
DISPQVTPSKTPTLTPTEQSIATTIKGSWYLLNVRSKKREVFLKFLNIAIAKNNLEEVIL
DIKIPQDSVYEDIVLLNLSNFNTANSQLQKIDHFQTLQRKPLPLEQVSRMIGNQ
Download sequence
Identical sequences Q3M827
240292.Ava_3251 gi|75909458|ref|YP_323754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]