SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909482|ref|YP_323778.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909482|ref|YP_323778.1|
Domain Number 1 Region: 859-1176
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.39e-100
Family WD40-repeat 0.00000281
Further Details:      
 
Domain Number 2 Region: 1142-1434
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.71e-95
Family WD40-repeat 0.00000577
Further Details:      
 
Domain Number 3 Region: 362-556
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000497
Family G proteins 0.055
Further Details:      
 
Domain Number 4 Region: 820-856
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000288
Family Pentapeptide repeats 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909482|ref|YP_323778.1|
Sequence length 1474
Comment pentapeptide repeat-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MSLINLDLVISAVTSIANPVIKEKILRSETVIKLLQQFNLDPEHPPADFSGVYAYTLVEY
GVGKPKAFLELFRQEAIKQAFRKALGHNNPSILLSEVDAFLDSYTLGDEIRSLELDVRRE
VAAFATVFIEVAKRSRTPADVLMSQQIGSLHKRIASIQEQLERLPTLEGIRTEIARLAAQ
NYPALAGATTENQCRAIALAQQMRGWFETLGYRLEKYEIWAEDYFEWIINVPVRRSYDRI
LVRGVAGEVRLSDVMALRQSVNQQKTDEGWLVSNRRIARAARDEVKKEENRHLDCFTFDE
LIDLDADFTGYLDWLEAEIKRRKIDQKYVPLACTKEEIDPVTKRRIGVSRYEAEDGWIDG
YIDLWLDDPAKEHISILGEFGTGKTWFVFHYAWTALQRYKDAQKRGVERPRLPLVITLRD
FAKALNVENVLAGFFFTQHNIRLNSEVFDQLNRMGKLLLIFDGFDEMAAKIDRQQMINNF
WELAKVVVPGSKVILTCRTEHFPESKEGRALLNAELQASTNKLTGETPQFEVLELEKFND
EQIRQVLLYQAEAATVEQVMDNSQLLDLARRPVMTDLILEALPDIESGKPIDMSRVYLYA
VRRKMERDIKAERTFTSLADKLYFLCELSWEMLSTDQMSLNYRLFPERIRRLFDSVVQEE
KDLDHWHYDMMGQTMLVRNADGDYTPAHRSLLEFFVAYKFAAELGALAEDFTALAQAQSG
LDSGATPVDYTWFGYFSRQWNDIIAPLKAFTRESFEKLRETFGKAPLTKAVIDLLVPMLS
NNESLISVIERTRGQSEDAVGYIGGNAATLVLRIDPLGLEGKDLSGTVIKGADFTNVNLQ
NVNFFAANLVNCAFTRTLGAVFSVAFNSDCKLLATGDGNGIVRLLDAATCKEILICKGHG
SIIPCVAFSPSAQILASGSYDQTIKLWSIQTGECLKILQGHVSGIRSIAFSPSGAILASS
GNDNIIRLWNIDTGESLKTLHGHRDHVYSVAFDPSGMILVSGSGDQTIRIWDINSGKCLK
ILEGHTNAIRSIALNSTGEIIASSSSDHTIGLWDIKTGKCLNILRGHTDNVMSVVFNNSD
RIIASGGADHTVRLWDVQSGECLNVIQGHTNVVRSVAFNSSGQTLASGSYDKTLKIWDIN
TYECLTTVQGHTNWISSVAFNPSGRTFASGGNDATIIWDANTGKCLKTLQIHTAWVFSVA
FSSCGKMLASSSADAKVRLWNIDTGECLKILNGHTYWVFSVAFSADGKLLASSGSDKTLK
VWSIETGQCLTTIHANQGTVHSVAFNPVNRTLANGGFDSQVKLWDVNTGECLKILQGHSG
TIRSVDFHPGGKILASGSADCTIRLWDVDTSECVKILQGHSKVVQSIAFSSDGQILATGS
EDFTIKLWNIFTGECFQTLWGHTTWVLSVAFSPDCKTLISGSQDETIKVWDIKTGDCIKT
LRSDRFYERMNITRVKGLISSEIATLKSLGAIEE
Download sequence
Identical sequences A0A1W5CBS3 Q3M803
240292.Ava_3275 gi|75909482|ref|YP_323778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]