SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909654|ref|YP_323950.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909654|ref|YP_323950.1|
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily Ribosomal protein L20 8.11e-52
Family Ribosomal protein L20 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909654|ref|YP_323950.1|
Sequence length 118
Comment 50S ribosomal protein L20 [Anabaena variabilis ATCC 29413]
Sequence
MTRVKRGNVARKRRNKILKLAKGFRGSHSTLFRTANQQVMKALRSAYRDRKKKKRDFRRL
WITRINAAARQHGLSYSQLIGNLKKADIQLNRKMLAQLAVLDPASFGKVAELAIQAKG
Download sequence
Identical sequences A0A1W5CDS1 Q3M7I1
gi|75909654|ref|YP_323950.1| 240292.Ava_3448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]