SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909680|ref|YP_323976.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909680|ref|YP_323976.1|
Domain Number 1 Region: 261-513
Classification Level Classification E-value
Superfamily HemD-like 2.49e-69
Family HemD-like 0.0036
Further Details:      
 
Domain Number 2 Region: 3-237
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.44e-64
Family Tetrapyrrole methylase 0.0000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909680|ref|YP_323976.1|
Sequence length 517
Comment uroporphyrinogen-III synthase / uroporphyrinogen-III C-methyltransferase [Anabaena variabilis ATCC 29413]
Sequence
MTQQNGKVYLVGAGPGDVAYLTVKAYNLLATAQVLVYDALVDEQLLQCVSPDCLKLDVGK
RGGKPSTPQADINHLLVKYCQEGALVVRLKSGDPFIFGRCTSEIEALKAAGCKFEVVPGI
SSSIAAPLLAGIPLTDPVMSRCFAVLTAHEPEVLDWEALSRLDTLVILMGGKNLADIINE
LLRRGQSHLTPIAIIRWAGTPSQQIWTGQLGDILEQTRGLSLSPAVIVIGEVVGLRKYLQ
PEKIFPENSTTPMSSNQPLTGKTILVTRSSGQSSQFSDRLTTLGATVIEMPALEIGSPSS
WEELDQAIANLSQFEWLILTSTNGVDYFFERLNLQGKDTRALAGVKIAVVGEKTSQSLKQ
RGIQADFIPPNFVADSLVEHFPESLLNKKILFPRVESGGREILVKELSAKGAEVIEVAAY
QSCCPSSIPPAAELALKNHTIDIITFASSKTVQFFHQLVDNIFPHNIPNTLAGICIASIG
PQTSKTCHTLLGRVDVEAEEYTLDGLTQSIINWALKV
Download sequence
Identical sequences A0A1W5CE51 Q3M7F5
240292.Ava_3474 397017 gi|75909680|ref|YP_323976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]