SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909739|ref|YP_324035.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909739|ref|YP_324035.1|
Domain Number 1 Region: 355-541
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.36e-62
Family Pyruvate oxidase and decarboxylase PP module 0.0000465
Further Details:      
 
Domain Number 2 Region: 1-170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.06e-52
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000223
Further Details:      
 
Domain Number 3 Region: 179-360
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.91e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909739|ref|YP_324035.1|
Sequence length 547
Comment acetolactate synthase [Anabaena variabilis ATCC 29413]
Sequence
MNTAELLVQCLENEGVQYVFGLPGEENLHVLEALKHSSIQFITTRHEQGAAFMADVYGRL
TGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAMFAP
VTKWNKQIVRPSITPEVVRKAFKRSQSEKPGAVHIDLPENIAAMPVEGKPLQKDNIEKTY
ASFASIRAAAAAISQAVNPLILVGNGAIRAKASDAVTQFATQMNIPVANTFMGKGVIPYT
HPLALWSVGLQQRDFITCGFDNTDLVIAIGYDLIEFSPKKWNPEGKIPIVHIGADSAEID
SSYIPNVSVIGDISDSLVEILKVADRQGKPNPYAISLRGNIREDYEQYANDDGYPIKPQK
LIYDLRQVMGPDDIVISDVGAHKMWIARHYHCHSPNTCIISNGFAAMGIAIPGALAAKLV
YPNRKVVAATGDGGFMMNCQELETALRVGTPFVTLIFNDGGYGLIEWKQENQFGKGQSSF
VHFGNPDFVKLAESMGLKGYRVESALDLIPVLKEALAQDVPAVIDCPVDYRENRRFTQKA
GELSCSV
Download sequence
Identical sequences A0A1W5CBF0 A0A1Z4KJM7 Q3M796 Q8YR93
gi|75909739|ref|YP_324035.1| gi|17231047|ref|NP_487595.1| 103690.all3555 240292.Ava_3533 WP_010997705.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]