SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909818|ref|YP_324114.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909818|ref|YP_324114.1|
Domain Number 1 Region: 1-24
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.000000403
Family Ribosomal protein L32p 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75909818|ref|YP_324114.1|
Sequence length 57
Comment 50S ribosomal protein L32 [Anabaena variabilis ATCC 29413]
Sequence
MAVPKKKTSKSKRDKRRATWRHKAAVEAQKALSLGKSILTGRSTFVYPTAEEEDEEE
Download sequence
Identical sequences A0A0S3PHP6 A0A1W5CNX2 A0A1Z4I5S2 A0A2I8ADX9 K9QQP0 Q3M717
gi|75909818|ref|YP_324114.1| gi|427728836|ref|YP_007075073.1| 240292.Ava_3613 WP_011320324.1.33109 WP_011320324.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]