SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909830|ref|YP_324126.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75909830|ref|YP_324126.1|
Domain Number - Region: 12-92
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00549
Family GSPII protein E N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909830|ref|YP_324126.1|
Sequence length 95
Comment hypothetical protein Ava_3625 [Anabaena variabilis ATCC 29413]
Sequence
MSLINHQSNSQRLTEIVKTLIDNNHLYQENLNKQEMIAMINRTFDPSVVPDLESISEEEL
TKRIKSILSLNLVSGMLNDLTPEQMQIFDESVRRG
Download sequence
Identical sequences A0A1W5CNP0 Q3M705
240292.Ava_3625 2005405859 2005406070 gi|75909830|ref|YP_324126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]