SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909894|ref|YP_324190.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75909894|ref|YP_324190.1|
Domain Number - Region: 347-372
Classification Level Classification E-value
Superfamily YggU-like 0.0536
Family YggU-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909894|ref|YP_324190.1|
Sequence length 811
Comment type II and III secretion system protein [Anabaena variabilis ATCC 29413]
Sequence
MKHVHGNGLVLGAAAFVFLAAQPVWAQTTQITEVKLNPGNGGLSVVLKTSAGSRPQVFTT
KRGKALVADVINTQLRLPQGNNFRQDKPAAGIASVEVVQLDANSIRVIVTGDTDAPVSQP
VTRQQDGITLSLTPSSGTTASAPVTPRPPVSTTPPAATPAQTGAVPNVLVPNPVVTIDGK
PAQPAGPGQPLSQAPPFLPRAVAPPVGDIAISATDASPSTIDLGTQERVPRLVLRDAPVR
EVLSLLARAANLNLAYISDGAGGTPGAGGQAISQTISLDIENEPVQDVFNYVLRLSGLEA
NRSNRTIFVGPKLPNSTRDVVMRNLRLNQVTVGVALNFLVGLGAESAISRERLVTSVNAV
PVGGAANAAVTQTQTTTESRIETQRVDFQDSKPLLRGLQALGDERTNSVTLIGPPKQIEM
AIAQLTQLDIRRRQVVVNVKIVDVNLLNLQDTNASFSFGLGNNYFTSDGGAATLNFGGSR
PATSSEVANSLTGTPTIENPITGTPFLNPNSSVSIPGTTPGTVVVDANGNITRVANPGSG
SFYQPIAPSNTNPLQPGFSDITPATDNIITRNADGTTTITQGTLGTATTSLPTIYQFPKR
LLASLQAQVQNGNAKVLTDPTLIVQEGQQAVVKLTTEVFGGFEESGQSSSTGSNTQSSST
KKPIIKEAGLSLNVKVERIDDNGFVSLSVAPTVSAPGGSTQTSDGQITLLSARSLQSGLI
RLRDGQTLILSGIIQESDRSTVSKLPILGDLPLIGSLFRKTNRTNERREVIVLLTPQVMD
DSQNSSYGYNYSPSPEVRQLLERRGLNTPRR
Download sequence
Identical sequences A0A1W5CLJ7 Q3M6U1
240292.Ava_3689 gi|75909894|ref|YP_324190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]