SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909973|ref|YP_324269.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909973|ref|YP_324269.1|
Domain Number 1 Region: 40-218
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.26e-42
Family Phosphoglucomutase, first 3 domains 0.00047
Further Details:      
 
Domain Number 2 Region: 296-403
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.51e-31
Family Phosphoglucomutase, first 3 domains 0.0023
Further Details:      
 
Domain Number 3 Region: 194-294
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 6.67e-26
Family Phosphoglucomutase, first 3 domains 0.00069
Further Details:      
 
Domain Number 4 Region: 398-488
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 2.22e-20
Family Phosphoglucomutase, C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909973|ref|YP_324269.1|
Sequence length 490
Comment phosphoglucosamine mutase [Anabaena variabilis ATCC 29413]
Sequence
MVSSITRIQNYVIDGAATSDGLATVLESNFAPSLISLPATPLFGTDGIRGKVGELLSAPL
ALQIGFWAGVVLRSHAGQLRPVILGQDSRNSSDMLAMALSAGLTAAGLEVWYLGLCPTPC
VAYLTSVSEAIGGVMISASHNPPEDNGIKIFGANGGKLSQALQAEIEKGLRGNLPITSNV
SNCGRHYSRRELVKDYGEALKRPWQNKVNLQGMKVVLDLAWGAAVGLAPSVFAEMGAEVI
SLHNAADGDRINVNCGSTHLEMLQAAVQEHNADLGFAFDGDADRVLAVDPTGRPVNGDYI
LYLWGLHLKQQNQLPDNLIVSTVMANLGFEKAWQQQGGKLIRTAVGDQYVQAEMIKTGAM
LGGEQSGHILCSHYGMTGDGLLTALHLASLVKQSGVSLAELIDQSFQTYPQLLRNVRVVD
RDRRLNWQNCTPVQQAIALAEKAMGDTGRILVRASGTEPVIRVMVEAANAELANYWTNEL
VAQVQQHLAP
Download sequence
Identical sequences A0A1W5CLF9 Q3M6L2
240292.Ava_3769 gi|75909973|ref|YP_324269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]