SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75909978|ref|YP_324274.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909978|ref|YP_324274.1|
Domain Number 1 Region: 25-223,433-686
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.92e-143
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000119
Further Details:      
 
Domain Number 2 Region: 693-975
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.23e-75
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000012
Further Details:      
 
Domain Number 3 Region: 227-433
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.47e-49
Family ValRS/IleRS/LeuRS editing domain 0.00000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75909978|ref|YP_324274.1|
Sequence length 978
Comment isoleucyl-tRNA synthetase [Anabaena variabilis ATCC 29413]
Sequence
MPSSIIDRTCIHNLRHEAVTETGSYKDTVNLPKTNFDMRANAIKREPEIQKFWEENKIFE
RLSQNNPGELFILHDGPPYANGSLHIGHALNKILKDIINRYQLLQGRKVRYVPGWDCHGL
PIELKVLQNLKSAERQNLTPLQLRQKAKEFALATVDDQRQNFKRYGVWGDWDHPYLTLKP
EYEAAQIGVFGQMVLKGYIYRGLKPVHWSPSSKTALAEAELEYPEGHTSRSIYAAFPVTG
LAEAVKSVLGEYLPDLGVAIWTTTPWTIPGNLAVAVNGDLNYAVVEVAQIDVETQSNFKY
LIVAAELVERLAATISAQLTVKATFKGKELEHTTYRHPLFDRESPVVVGGDYITTESGTG
LVHTAPGHGQEDYVVGLRYGLPILAPVDDNGDFTQEAGEFAGLNVLGDGNQAVIDALTAA
GSLLKEEAYAHKYPYDWRTKKPTIFRATEQWFASVEGFRDEALKAIATVKWIPAQGENRI
TPMVAERSDWCISRQRSWGVPIPVFYDEETGEPLLNEETINYVQAIIAEKGSDAWWELSV
EELLPESYRNNGRSYRRGTDTMDVWFDSGSSWASVVKQRPELRYPADMYLEGSDQHRGWF
QSSLLTSVAVNGIAPYKTVLTHGFVLDEQGRKMSKSEGNVVDPKILISGGKDQKKEPPYG
ADVMRLWASSVDYTGDVRLGGNIIKQLNDVRGKIRNTARFLLGSLHDFDPEKNAVQFEEM
PQLDRYMLHRIREVFQEVTEAFESFQFFRFFQTVQNFCVVDLSNFYLDVAKDRLYISAPD
AFRRRSCQTVIHIALQNLARAIAPVLCHTAEDIWQYLPYKTPYKSVFEAGWVQVEKKWHN
PELAEFWQQLRQLRTDVNKVLEQARVEKMIGSSLEAKALIYVKDANSRNAIATLNPEVGN
GVDELRYLFLTSQVELLDSADKLQDGKYTSQSDNWGIGVVNAEGQKCDRCWNYSTHVGES
QEHPLLCERCVPALAGEF
Download sequence
Identical sequences Q3M6K7
gi|75909978|ref|YP_324274.1| 240292.Ava_3774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]