SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75909979|ref|YP_324275.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75909979|ref|YP_324275.1|
Domain Number 1 Region: 261-379
Classification Level Classification E-value
Superfamily CheY-like 3.84e-30
Family CheY-related 0.0021
Further Details:      
 
Domain Number 2 Region: 124-190
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000237
Family I set domains 0.021
Further Details:      
 
Weak hits

Sequence:  gi|75909979|ref|YP_324275.1|
Domain Number - Region: 195-281
Classification Level Classification E-value
Superfamily Ribosomal protein S2 0.0589
Family Ribosomal protein S2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75909979|ref|YP_324275.1|
Sequence length 394
Comment response regulator receiver domain-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MVSNNVLNEFKTCTQLQYNGQLIINSPKGQQWTFYYRLGRIVWATGGTHPFRRWRRLMAQ
HCPQIDVDKMQLRPQDISMSYWDYRLLEILYKKQKIQREQIHNIVDNTINELLFELAQQS
NFVSISCERNQKVILETPMSFTSADVSMKQMLESWKNWSEAGLVNICPDLAPVICRPEQL
QQQVSPSVYKNFVTLINGKSTLRDLAAKMKQNVLPVSRSLLPYVLKGIIELVELPDLPLA
VVETLNKATSAQPTKSKVPVIACVDDSPQVCKLLEDIITANGMKFIKIQDAVQALPLLIQ
EKPDLIFLDLIMPVASGYEICTQLRRIPTFANTPVIILTGNDGLLDRVRAKVVGSTDFLT
KPVAADRVMSVVRKYLPMQTTSPAKTGSHLEFCQ
Download sequence
Identical sequences A0A1W5CLK3 Q3M6K6
240292.Ava_3775 gi|75909979|ref|YP_324275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]