SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910042|ref|YP_324338.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910042|ref|YP_324338.1|
Domain Number 1 Region: 298-500
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.27e-53
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000155
Further Details:      
 
Domain Number 2 Region: 832-1027
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.89e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000442
Further Details:      
 
Domain Number 3 Region: 567-671
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.35e-32
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00053
Further Details:      
 
Domain Number 4 Region: 672-722,809-858
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.18e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0017
Further Details:      
 
Domain Number 5 Region: 39-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.92e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0001
Further Details:      
 
Domain Number 6 Region: 137-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.88e-26
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0015
Further Details:      
 
Domain Number 7 Region: 723-807
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.35e-23
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00033
Further Details:      
 
Domain Number 8 Region: 184-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 6.28e-19
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75910042|ref|YP_324338.1|
Sequence length 1057
Comment hydrophobe/amphiphile efflux-1 HAE1 protein [Anabaena variabilis ATCC 29413]
Sequence
MFVDFFIRRPVFTSVCAIIILLVGAISIPTLPTDRYPEISPTQIVVNANYTGASAEVVEN
TVTSILERQINGVQGMKYMTSSSSNDGTSTITVTFDPSRDKDIAAVDVQNRVSIAQPQLP
EAVQRTGVTVSKQSNNILLAMGLYSEQQEYDTVFLSNYADQYIVDALKRLDGVGEARIFG
ERRYAMRLWLDPNRLTSRKLTAQDVIDAINEQNIQVGVGQIGQQPSLPDQMYQIDLQARG
RLSEATEFADMVIKTGTDGTLIKLKDVGRAELGAENYSSFLRFRGNEGVGIGIFPTPGSN
ALEVSKAVKAEMARLAQSFPPGLKYQVAFDTTLFVEESLAEVVKTLIEALILVVLVIFLF
LQDWRTTLIPVITIPLTLIGTFAFIKVFGFSINTLTLFGLTLATGLVVDDAIIVVENISR
LIEEEGMSPRQAASESMRELFGAVIATSLVLMAVFVPVAFFPGTTGQIYKQFALTIAFSM
AISTFLALTLTPSLSALLLRRGQRPRGWLGKIFHQINRFLDWMRRGYERSLNILVKVRAI
VVLLFLASIALTGWVYLSVPTAFIPDEDQGYFITIIQGPEGVSLNYTSNVMAQVEKEILK
LPEVTGTFAIGGFSFSGNSANSGVIFTTLQPWDERQQPGQSAPEIIGKLAGVFANITEAR
IFPVSPPPINGLGNFGGFQFELQDRAGNSGLDNLLQVMGQIMMKGNQTPGLQGVFSTFSA
NTPQMLIDIDRNKVKALQVNVDDVFNTLQSYLGSRYVNDFNFQQRTYRVYVQADAPFRSN
PEDIGKLYVRSANDQMISLSNLVKITPATGAQTINHYNLFRSITINGAAAPGYSSGQATT
AMEKLAKEVLPASMGYEWSGITAEEQESGGQAPVIFGLGLVFVFLVLAAQYENYVDPLII
MLSVPLAILGALSAQWLRGLSNDVFCQVGLVMLIGLASKNAILIVEFANQLRERGLPIIK
ATVQASQERLRPILMTSLSFILGVWPLINPIGAGAASRKSLGTAVAGGMIVSTVLSLFVV
PILYIVISKIRDRFRPKPPHIPLDSTRDDKIPSTSHR
Download sequence
Identical sequences A0A1W5CLY1 Q3M6E3
240292.Ava_3838 gi|75910042|ref|YP_324338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]