SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910144|ref|YP_324440.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910144|ref|YP_324440.1|
Domain Number 1 Region: 12-97
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.78e-29
Family 2Fe-2S ferredoxin-related 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910144|ref|YP_324440.1|
Sequence length 99
Comment ferredoxin [Anabaena variabilis ATCC 29413]
Sequence
MATYQVRLISKKENIDTTIEIDEETTILDGAEENGIELPFSCHSGSCSSCVGKVVEGEVD
QSDQIFLDDEQVGKGFALLCVTYPRSNCTIKTHQEPYLA
Download sequence
Identical sequences A0A1W5CM20 P46046
240292.Ava_3940 gi|75910144|ref|YP_324440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]