SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910204|ref|YP_324500.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910204|ref|YP_324500.1|
Domain Number 1 Region: 48-278
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.24e-67
Family DNA/RNA non-specific endonuclease 0.000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910204|ref|YP_324500.1|
Sequence length 281
Comment DNA/RNA non-specific endonuclease [Anabaena variabilis ATCC 29413]
Sequence
MKKSKFSKTILLIALPAISLILLSYLQNPLTAQTSSVHLTMGNPSGANTSYSNLLLSKPQ
YAVSYNCYRGTPNWVSWQLNTSWLGSAPRQDDFRADTTLPSGCYRVTSSDYSGSGFDRGH
MTPSADRTNTIANNSATFLMTNMIPQAPDNNQGVWANLENYCRDLVVNQGKELYIISGSY
GTGGTGSNGTFSTIAGGKVTVPARTWKVIVVLNRPNSGAASVTTSTRVIAVNIPNTQGVR
YANWRDYRVSVDSIEVNTGYDLLSNVSTTTQSVIEARVDNL
Download sequence
Identical sequences A0A1W5CM71 Q3M5Y1
240292.Ava_4000 gi|75910204|ref|YP_324500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]