SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910393|ref|YP_324689.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910393|ref|YP_324689.1|
Domain Number 1 Region: 66-73,108-475
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.96e-25
Family Galactose oxidase, central domain 0.0039
Further Details:      
 
Domain Number 2 Region: 547-648
Classification Level Classification E-value
Superfamily E set domains 1.36e-19
Family E-set domains of sugar-utilizing enzymes 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910393|ref|YP_324689.1|
Sequence length 650
Comment hypothetical protein Ava_4195 [Anabaena variabilis ATCC 29413]
Sequence
MIVSKSKRLTIVSVFIIFILAFVISLCGWEQAIAAPIIGTKEEMGAWETLPMPPLEDRMQ
SVHTILLPNGKVLVVNGSSFRTTQVKEQENVDLVEGVDVRNYDVINNTGLLDPVTGKFER
IPSPPSIQAGETNDLFCTGHLQLSNGNILFVSGTGRYYPGGAFTGNRQINLYNWKTGTWS
ALKPLKQGRWYPSLISLADGKVVIFSGLKVDAPNQINPTLEIYDPKTEKLQYIDLTTVKN
SPFNTKLKDVDSYDSIDLYPRVFPTADGRLLITGDEAGIAGVLVPHSSKKSYLMSIKENT
EGTLSVSFEVGPDRAESSKAYGTALQVPNSEDVLLLGGIIGTNSINFGRLNNTQGFPPGS
RVATSLQRWLSPAKSGEKNGKWEIVPNFLDKPRANLQSVILPTQEILVVNGGQYPEYKPV
YEPLLMTAAQDAPGGYQTKPMNPAKLPRLYHNGALLLPDARVLAIGGNANRALRDEDGTV
HVDILQDAKTYYKFADLRDKSGQKKEFNLEEYYQNPQSYFAKGDEEPFVPAEIWQGEVFS
PPYLFKPGSRPKIVKAPSSLAYSQSNTISVKNATQDGSLVLVKLGAVTHSFDYGQRLAQL
PIENVVLADESSISFKTPENKNLYPPGYYMMFYLNNVGKPSLAKIVKLAA
Download sequence
Identical sequences A0A1W5CF37 Q3M5E2
gi|75910393|ref|YP_324689.1| 240292.Ava_4195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]