SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910534|ref|YP_324830.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75910534|ref|YP_324830.1|
Domain Number - Region: 21-153
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0275
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910534|ref|YP_324830.1|
Sequence length 161
Comment hypothetical protein Ava_4337 [Anabaena variabilis ATCC 29413]
Sequence
MVNWSEVLEPIAAWFRSLGVPEPIVHWGHPLMMAIVIFILGSYVGWAGWRGKLLEEKDND
GAIKNRIAHRQLAPLLFLFLAGGYTGGVLSLVMQHKPLFESPHFWTGSLVLFVLLINGGI
SLSGFGGDKKILRAVHAYLGSVAIAILFVHAVLGFNLGISL
Download sequence
Identical sequences A0A1W5CQK4 Q3M501
240292.Ava_4337 gi|75910534|ref|YP_324830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]