SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910563|ref|YP_324859.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910563|ref|YP_324859.1|
Domain Number 1 Region: 165-451
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 3.27e-58
Family Creatinase/aminopeptidase 0.00000907
Further Details:      
 
Domain Number 2 Region: 7-159
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 4.08e-25
Family Creatinase/prolidase N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910563|ref|YP_324859.1|
Sequence length 455
Comment peptidase M24 [Anabaena variabilis ATCC 29413]
Sequence
MGSLADTLRDRRQKLARLIDFPAILWSGGSNARNFPANRFPFRASSHFLYFAGLPLPNAA
IHLEAGKLTLFIDDPAPGSALWHGETPKREEIAETIGADAAKPLSELTPFLAGAATIAVQ
DATTWTQQSQLLNRWVLPQSQPEGIDLELTKAIVTLRLIHDAGALAELRKAATVSVAAHK
AGMVATANAKIEAEVRAAMESVFIAHNMTTAYNSIVTVHGEVLHNEQYHHPLQPGDLLLA
DVGGETELGWAADITRTWPVSGKFSPTQRDIYDVVLAAHDTCIANILPGVEYAEIHLVGA
RVIAEGLVNLGILRGNPEDLVEKDAHALFFPHGIGHLLGLDVHDMEDLGDLAGYEEGKKR
SDRFGLGYLRLNRPLRTGMLVTIEPGFYQVPAILNDEKIRSRYQYTVNWERLSQFADVRG
IRIEDDVLVTDTGSEVLTAALPNDADTVEHLVNKI
Download sequence
Identical sequences A0A1W5CQI3 Q3M4X2
gi|75910563|ref|YP_324859.1| 375345 240292.Ava_4366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]