SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910610|ref|YP_324906.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910610|ref|YP_324906.1|
Domain Number 1 Region: 139-319
Classification Level Classification E-value
Superfamily alpha/beta knot 1.05e-48
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0000259
Further Details:      
 
Domain Number 2 Region: 67-148
Classification Level Classification E-value
Superfamily L30e-like 3.3e-20
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75910610|ref|YP_324906.1|
Sequence length 327
Comment RNA methyl transferase TrmH [Anabaena variabilis ATCC 29413]
Sequence
MTNKPKKIKTTSEANRGQPVKIKGKRVIANPIRSHRNGESNPTSSNSSSRPPRPRRQFSD
AAPIPKVKEENESDIIYGRHPVLSALENQRGLNRIWVTPRLRYDPRFHNLILQAKENGAV
IDEVEPKRLDQITDQANHQGIAAQIAPYSYIEFYELIAQAKSVTDPVIIVADGITDPHNL
GAIIRTAEAIGAQGLVIPQRRASGITSTVVKVAAGALENFPVARVVNLSRALEDLKEAGF
WIYGTAAGGSEPLHTVSFRGPIVLVIGSEGEGLSMLTQRSCDVLVSIPLMGKTPSLNASV
AAGMALYEIFRQRSLNTLYLDKLPKPL
Download sequence
Identical sequences A0A1W5CL66 Q3M4S5
gi|75910610|ref|YP_324906.1| 240292.Ava_4413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]