SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910661|ref|YP_324957.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910661|ref|YP_324957.1|
Domain Number 1 Region: 30-491
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 7.98e-172
Family Type II DNA topoisomerase 0.000000000272
Further Details:      
 
Domain Number 2 Region: 503-712,760-870
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 7.85e-95
Family GyrA/ParC C-terminal domain-like 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910661|ref|YP_324957.1|
Sequence length 872
Comment DNA gyrase subunit A [Anabaena variabilis ATCC 29413]
Sequence
MTTSQERIIPTDLRNEMSRSYLEYAMSVIVGRALPDARDGLKPVHRRILYAMHELGLTHD
RPFKKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRSPLVNGHGNFGSVDNDPPAAM
RYTECRLQALTSSALLQDIESETVDFADNFDGSQQEPTVLPSRIPQLLLNGSSGIAVGMA
TNIPPHNLGELIDGVVAVIHNPEITDLQLMQYIHGPDFPTGAQILGMGAIKEAYTTGRGS
ITMRGVANIETIEHRGRPDREAIIITELPYQTNKAALIEKIAELVNEKRIEGIADIRDES
DRDGMRIVIELKRDAYPRVVLNNLYKQTPLQANFGANMLALVNGEPQILTLKQFLNVFLD
FRIESITRRTRYELRKAEERDHLLQGLLIALSHLDAIINLIRSASDTPTAKGELITTYML
SEVQADAILQMQLRRLTALEADKIRLEHEDLQTQIADLQDILARRERILEIIETEITQIK
TSFATPRRTVITHAEGEIDERDLIANEKAIILLTQQGYIKRMPVNTFEAQSRATRGKAAA
KVKDDDTIEHFLTCCDHDSVLFFSDRGVVYCLKAYQIPVSSRTSRGTPIVQLLPIPKEEK
ITSIVPVDEFTSEEYLVMLTKGGNIKKTELAAFSNIRANGLIAISLEEGDQLRWVRRARV
EDSIIIGSRLGMAIHFRCTHEQLRPLGRATRGVKSMKLKKGDELVGMDILPAAILDTLNT
EEPDIDDIETEDIETAVETTEVLETLENLEAVEVSSNASVGPWVLVITMGGYGKRVPVSQ
FRLQNRAGQGLMATKFKNRKTKDKLATLGIVNSDNEIMMVTNRGIIIRQAVNAISIQSRS
ATGVRVQRLDEDDAITGVAIVPPDTGDEEEAE
Download sequence
Identical sequences A0A1W5CL27 Q3M4M4
gi|75910661|ref|YP_324957.1| 240292.Ava_4464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]