SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910676|ref|YP_324972.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910676|ref|YP_324972.1|
Domain Number 1 Region: 99-468
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.09e-94
Family Amylase, catalytic domain 0.0000208
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily E set domains 0.000000000000104
Family AMPK-beta glycogen binding domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 472-551
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000192
Family alpha-Amylases, C-terminal beta-sheet domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910676|ref|YP_324972.1|
Sequence length 552
Comment glycoside hydrolase family protein [Anabaena variabilis ATCC 29413]
Sequence
MAKPIEFTLFAPYNKGAALIASFSDWQEIPMQKGDDGYFRATIELEDGTYQYKFRVQTRS
WFFEEDQWVDVTDPYATDIDESSGKDNGIIKIKDGEKIVDTYVWQHDDKPLPADHELVIY
ELHVGDFSGGEDDLYARGKYKHVIEKLDYLCELGINAIELLPVKEYPGDYSWGYNPRYFF
ATESSYGSTADLKKLVDECHQRGIRIIMDGIYNHSEASSPLTQIDHDYWYHHEPRDPDNN
WGPEFNYEHYDENLETYPARKFIGDTVRYWVGEYHLDGIRYDAARQIANYDFMHWIAQEA
KKTAGAKPFYNVAEHIPETTSITNLDGPMDGCWHDSFYHTIKAHICGDTFDLESLKDVID
PKRQGFLGATNVVNYLTNHDHDHIMVELGNREIFHDEAFRRAKLGTAILMTAVGVPLIWM
GEEFGEYKPKQQDQSKIDWTLLGNDLNRSLFDYYRGLIGLRKNNHALYTENIDFIHENPE
AKVLAYSRWNDEGSRVVVVTNFSEDFLAGYHVPNFPSGGTWHEWTGDYDVEAGDDGIITD
IGPYEAKVFVWQ
Download sequence
Identical sequences A0A1W5CL11 Q3M4K9
240292.Ava_4479 gi|75910676|ref|YP_324972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]