SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910812|ref|YP_325108.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910812|ref|YP_325108.1|
Domain Number 1 Region: 183-643
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.12e-118
Family Amylase, catalytic domain 0.00000000551
Further Details:      
 
Domain Number 2 Region: 651-754
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.13e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.00028
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily E set domains 4.2e-17
Family E-set domains of sugar-utilizing enzymes 0.0097
Further Details:      
 
Domain Number 4 Region: 141-197
Classification Level Classification E-value
Superfamily E set domains 0.000000049
Family E-set domains of sugar-utilizing enzymes 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910812|ref|YP_325108.1|
Sequence length 764
Comment glycogen branching protein [Anabaena variabilis ATCC 29413]
Sequence
MPMTTIAPEQVNRIVWNQHHDPFEILGSHPIEQNGKNVWVVRAYLPNASAAWVVLPEQRQ
EYAMQTVHDPHFFECIIETSELSNYQLKTKEGEHERVSYDPYAFRSPRLTDFDLHLFAEG
NHHRIYEKLGAHFTEVDGVTGVYFAVWAPNARNVSVLGDFNLWDGRKHQMRKGATGVWEL
FIPEIGVGEHYKYEIKNFAGHIYEKSDPFGFQQEPRPKTASIVSNLNSYNWSDENWLEQR
RHTDPLTQPISVYEVHLGSWLHAASAEPAKLPNGETEPVVIASELNPGARFLTYRELASR
LIPYVKELGYTHIELLPIAEHPFDGSWGYQVTGYYAPTSRFGTPEDFMYFVDQCHQNNIG
VIVDWVPGHFPKDGHGLAFFDGTHLYEHADSRKGEHKEWGTLVFNYSRNEVRNFLVANAL
FWFDKYHIDGIRVDAVASMLYLDYCRKEGEWLPNQYGGRENLEAADFLRQVNHLLFSYFP
GVLSIAEESTDWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNVTFSM
WYNHSENFMLALSHDEVVHGKSNIIGKMPGDKWQKLANVRCLFAYMFAHPGKKTMFMSME
FGQWSEWNVWADLEWPLLQFEPHQQLKKFFTELNKLYRSEPALYTLDFAREGFDWIDCSD
NRHSVVSFIRREKDTENFVVVVCNFTPQPHSHYRIGVPEKGFYTELFNSDARQYGGSNMG
NLGGKWTDDWSMHSRPYSLDLCLPPLGVLILKMDKEKTAKASGS
Download sequence
Identical sequences Q3M473
240292.Ava_4616 gi|75910812|ref|YP_325108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]