SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910834|ref|YP_325130.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910834|ref|YP_325130.1|
Domain Number 1 Region: 61-294
Classification Level Classification E-value
Superfamily MetI-like 1.44e-57
Family MetI-like 0.00017
Further Details:      
 
Domain Number 2 Region: 6-53
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.00000116
Family MalF N-terminal region-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910834|ref|YP_325130.1|
Sequence length 308
Comment binding-protein dependent transport system inner membrane protein [Anabaena variabilis ATCC 29413]
Sequence
MNQLTVKDWILIKRRLTPYLFLLPALILLGLTVFWPALQAFYLSFTSYEDLSQPPQWIGI
KNFLRLWKDAVFWKTLENTFLYLVAVVPILVIAPLGLAILVNQKLRGINWFRAAYYTPVV
ISMVVAGIAWKWLYAENGLLNQLLKTIGLFPEGIPWLTTSAKVFGIVPISLASVMAVTIW
KGLGYYMVIYLAGLQSIPADVYEAAAIDGSDGISKHWDITIPLMKPYLALVAVISAISAT
KVFEEVYIMTQGGPLNSSKTIVYYLYEQAFSNLEISYACTIGLVLFLIILALSVLRLVIS
QPGGDGLV
Download sequence
Identical sequences A0A1W5CAW6 Q3M451
gi|75910834|ref|YP_325130.1| 240292.Ava_4638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]