SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910917|ref|YP_325213.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910917|ref|YP_325213.1|
Domain Number 1 Region: 17-500
Classification Level Classification E-value
Superfamily ADC synthase 8.37e-163
Family ADC synthase 0.000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910917|ref|YP_325213.1|
Sequence length 504
Comment anthranilate synthase, component I [Anabaena variabilis ATCC 29413]
Sequence
MIFPNFSEFSQLALQGNFVPVYQEWVADLDTPVSAWYKVCAGEPYSFLLESVEGGEKIGR
YSLLGCDPLWILEARGETTTQTNRDASQVVFTGDPFTALADCLAPYKPVKLPQLPPGIGG
LFGFWGYELIRWIEPRVPVHSQDERNIPDGLWMQVDHLLIFDQVKRKIWAIAYADLRDPN
VDLKAAYQQACDRVTQMVSKLSLPVSPQKTILEWTPPGSQNVGETQEYTSNFTRPEFCAS
VQKAKEYIKAGDIFQVVISQRLSTQYTGDPFSLYRSLRQINPSPYMAYFNFQDWQIIGSS
PEVMVKAELDGDGEAVATVRPIAGTRPRGKTTKEDAELAADLLQDPKEIAEHVMLVDLGR
NDLGRVCASGTVKVDELMVVERYSHVMHIVSNVVGKLAANKNAWDLLKACFPAGTVSGAP
KIRAMEIINELEPSRRGVYSGVYGYYDFEGQLNSAIAIRTMVVRDHTVTVQAGAGLVADS
DPEKEYEETLNKARGLLLAIRCLR
Download sequence
Identical sequences A0A1W5CB53 Q3M3W8
gi|75910917|ref|YP_325213.1| 240292.Ava_4721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]