SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75910931|ref|YP_325227.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910931|ref|YP_325227.1|
Domain Number 1 Region: 300-488
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.63e-40
Family Multidrug efflux transporter AcrB transmembrane domain 0.00016
Further Details:      
 
Domain Number 2 Region: 799-1021
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.15e-38
Family Multidrug efflux transporter AcrB transmembrane domain 0.0012
Further Details:      
 
Domain Number 3 Region: 38-129
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.27e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0024
Further Details:      
 
Domain Number 4 Region: 184-265
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000157
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0028
Further Details:      
 
Domain Number 5 Region: 146-181,269-325
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000209
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.017
Further Details:      
 
Domain Number 6 Region: 709-800
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000068
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.015
Further Details:      
 
Domain Number 7 Region: 556-652
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000115
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75910931|ref|YP_325227.1|
Sequence length 1029
Comment acriflavin resistance protein [Anabaena variabilis ATCC 29413]
Sequence
MNNLFYQNVRLLILTVLAIAVWGLSSFFSLPRIEDPEITPRFAVITTVFPGAAPERVETL
ITDKLEQSLFEVEEINNIESTSRLGFSSITVELNDTINDVDPVWSRVRAKINDTIPLLPS
GAATPKFEQSKPKANALIVALTWDLKSAPNYAILSRWAQELDDQIRLIGGTEKVEQFGTP
QEEIAIEVNPKQLTNLGLTIQSLSQQILQSDAKVAAGQLRSNQSNLLLEINGELDSLDRL
NRLSIQSGNSSNVVRLGDIAQIKKGILDPPRELALVNGRRAIAISAFVESQQRLDAWAAI
ANTTLKKFQQQLPKGVGLQILFDQSHYVEQRLNEVLMNLITGAVLVVGITLFMMGWKSSL
IVGSALPLSVFMVFGSMKLLGVPLHQISVTGLIIALGLLIDNAIIVVDEVQIYLREGLTP
KKAVATTVREIFSPLLASTFTSVLAFVPIATAPGGTGEFTGTIGVTVILALVSSLFLALT
VIPALAGRLHYWKPTPVSGSWWQVGFSHHHLGQFYSWSLDRTFSRPLLSIALSLILPLWG
FMSLANLEQQFFPPTDRGQFYLNFELPIQASLQQTQSQVTQARELMLRHPEIADVQWFIG
KSAPPFYYNVIQNRENSPNYAQGLVQLQKNVKSGSLIRTLQQELDQAFPAAQIIVRQLEQ
GPPFDAPIELRVYGSDLDRLRELGDQLRAELAKTPNVIHTRANLTETLPKLALNLDEEQL
RLAGLDKTAVARQLDTNLEGIVGGSIFEGTEELPVRVRSLESERGNLGDIASSTLLSPGN
SNQSGNRVVPLSAVGNVEIVPDVVTISRRNGKRVNTVQGFIPAGMLAAQVQTDFQNRLTA
SNFTLPSGYSWDFGGEEGERGDALSNLISTVGVLMIIMIASLVLTFSSFRLASIILVVAI
LSMGLGLGSLALFNYPFGFTAILGMIGLIGVAVNDSIVVLSSLNHDPKARQGDRYAARKV
VIRSTRHVIATTLTTIIGFTPLLLDTSGFWPPLAITIVGGLGGATLIALYFVPSVYLLLQ
RSLVKDSKK
Download sequence
Identical sequences A0A1W5CB44 Q3M3V4
240292.Ava_4735 gi|75910931|ref|YP_325227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]