SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75910936|ref|YP_325232.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75910936|ref|YP_325232.1|
Domain Number 1 Region: 221-272
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000941
Family AraC type transcriptional activator 0.031
Further Details:      
 
Domain Number 2 Region: 17-114
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000628
Family N-terminal PAS domain of Pas kinase 0.032
Further Details:      
 
Domain Number 3 Region: 169-218
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000529
Family AraC type transcriptional activator 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75910936|ref|YP_325232.1|
Sequence length 277
Comment AraC family transcriptional regulator [Anabaena variabilis ATCC 29413]
Sequence
MFSSQNLSSTNTYSQPNLAESVSLIQHLINQVKEAIFCLDYQGHFYYINDAACSLLGHSR
QKLLNMTIDEVEMDFLPSSWSYYWQLLKQQTSLTFKKVCSSQQYQSIEVTIKFLEHGSEL
LGCILAHTFSTNNPDIACDQDLYLEQENQPVNSSNKSLSSADFYPNCVQLRPIFEFIEQN
YHLPISLNDVAQAVGYSPAYLTNLVKRRTQLTIIDWILERKMLEARSLLINSDKSVTEIA
MAVGFTDAYYFSRRFSQYHKLSPRSWRQKYHYLQTIN
Download sequence
Identical sequences A0A1W5CB49 Q3M3U9
gi|75910936|ref|YP_325232.1| 240292.Ava_4740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]