SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75911106|ref|YP_325402.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75911106|ref|YP_325402.1|
Domain Number 1 Region: 128-263
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.03e-37
Family Pentapeptide repeats 0.00026
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.97e-35
Family Pentapeptide repeats 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|75911106|ref|YP_325402.1|
Sequence length 268
Comment pentapeptide repeat-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MANLEHLALLRAGAVRWIEWRQENPQIEPDLSTANLQENNLRGANLEGTNLSRVDLSHAL
LVRANLSGADLSSANLYQAKISEANLSAANFSVANLSQSILTQADLSHAHFIGADFSGAN
LRGAIVAEANLIGTDFSSADLRDADLAGAKLIRSNLCFANLIAANLIAADFSEANLYQAE
VMGAYLYKANFYKANLHKAHLGGAYLFRANLTAADLRGADLAWANLTSANLAGANLSGAN
LRGANLKGANLNGVNLQETIMPDSSRHD
Download sequence
Identical sequences A0A1W5CHN8 Q3M3C9
gi|75911106|ref|YP_325402.1| 240292.Ava_4910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]