SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75911114|ref|YP_325410.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75911114|ref|YP_325410.1|
Domain Number 1 Region: 15-116
Classification Level Classification E-value
Superfamily HisI-like 3.4e-47
Family HisI-like 0.0000608
Further Details:      
 
Domain Number 2 Region: 126-215
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 9.53e-26
Family HisE-like (PRA-PH) 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75911114|ref|YP_325410.1|
Sequence length 216
Comment bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase [Anabaena variabilis ATCC 29413]
Sequence
MSFIDSHSPQNVVPVEEIRYDERGLVPAIVQDYLDGTVLMMAWMNRESLQKTLDTGETWF
WSRSRQELWHKGGTSGHTQKVQSIRYDCDSDALLVGVEQIGDIACHTGERSCFHQVEGKI
VAPPGDTLSQVFQVICDRQNHPSESSYTSKLFAGGDNKILKKIGEESAEVVMACKDDDQE
AIAGEVADLLYHTLVALAHHQVDIKAVYRKLQERRR
Download sequence
Identical sequences A0A1W5CHR1 Q3M3C1
240292.Ava_4918 gi|75911114|ref|YP_325410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]