SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75911239|ref|YP_325535.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75911239|ref|YP_325535.1|
Domain Number 1 Region: 142-360
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.06e-53
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000715
Further Details:      
 
Domain Number 2 Region: 446-589
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.42e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000563
Further Details:      
 
Domain Number 3 Region: 13-141
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.18e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.0047
Further Details:      
 
Domain Number 4 Region: 362-438
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.13e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0031
Further Details:      
 
Domain Number 5 Region: 599-648
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000122
Family CopG-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75911239|ref|YP_325535.1|
Sequence length 650
Comment sulfite reductase subunit beta [Anabaena variabilis ATCC 29413]
Sequence
MVKSAPPPTTGRKPSKVEGLKENSNFLREPVATQILEDTTHFTEDAVQILKFHGSYQQDN
RDNRTKGQEKDYQFMLRTKNPGGLVPPQLYLALDKLADEYGNHTLRATTRQGFQMHGILK
KNLKAAIATIVKNLGSTLGACGDINRNVMAPPAPFKKRAEYQYAWEYAQNIADLLSPQTG
AYYEIWLDGEKAISAEESPEVKAARQSNGNGTIIHDTEEPLYGTYYMPRKFKVSVTVPGD
NSIDLYSQDLTLVVLTDKKGNLEGFNIFAGGGLGRTHNKEETFARLADPIGYVAKEDVYN
AVKAIVATQRDYGDRTDRRHARLKYLINDWGVDKFRAKVEEYFGKPIAPFKQLPEFKYHD
FLGWHEQGDGNLFLGISIDNGRVKDEGSFQLKTALREIVEQFNLPIRLTPNQNLIFYEIT
PENKPAIQAILDRCGVVSDPTTIEPLVRYAMACPALPTCGLAITESERAIPGILERIRTL
LDKVGLQNEHFVVRMTGCPNGCARPYMAELGFVGSAPESYQVWLGGSPNQTRLAQPYVEK
LHDNDIESFLEPIFVYFRKSRKSGESFGDFCDRVGFDGIREFVAQYQPETTPVTIEPEQP
EAVSKSRKARYRVSLHDDLYNKVKATATSQGRSMTDLVKDALEAYFQSLS
Download sequence
Identical sequences A0A1W5CHZ6 Q3M2Z6
gi|75911239|ref|YP_325535.1| 240292.Ava_5043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]