SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75812489|ref|YP_320108.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|75812489|ref|YP_320108.1|
Domain Number - Region: 252-320
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000876
Family Calcium ATPase, transmembrane domain M 0.029
Further Details:      
 
Domain Number - Region: 50-119
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0942
Family Galacturonase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|75812489|ref|YP_320108.1|
Sequence length 581
Comment potassium-transporting ATPase subunit A [Anabaena variabilis ATCC 29413]
Sequence
MLQGWLQIVLTLLIVVAITPFFGRYMARVYQEQRTLLDPILNPVERLVYSLIGVATKENM
TGWQYARAILYSNIVMGLLIFFIIMNQGWLPFNPTKIGAPTWDTALHTTISFITNTNQQH
YSGETYLSYASQMWGLGYHMFTSAATGLAVGIAFIRGLTGRPLGNFYVDLTRSITRVLLP
ICIVGGIALMAAGVPETLAGPVVFPTLEDPNISQAIARGPVAHFEIIKQLGENGGGFFAI
NSAHPFENPNGFSNLILIVAMISIPTSLIYTYGLFANNTKQAWLVYGMVGVIYVTFIIIT
AIGEYNGNPAVNALLGSTQPNLEGKEVRFGWAQSALFAVTTTGTMCGAVNSLHDSFMPNG
GFVTLSNMFLQIIWGGQGTGTAYLFAYLILAVFATGLMVGRTPEFLGRKIEKREVVLASF
LILLVHPIAIMIPAGIALAFPDQLAGISNPGFHGLSQVIYEYASAAANNGSGFEGLGDSQ
PSPIAIATGATTTTTALWWNLSACFSLLAGRYIPIIGLLLLADSLSRKQQVPFTAGTLRT
DTGLFTGVTAGVILILGALTFFPVLAFGPIGEAFWIARGIG
Download sequence
Identical sequences A0A1W5CAG6 Q3M267
gi|75812489|ref|YP_320108.1| 240292.Ava_B0207 gi|75812489|ref|YP_320108.1|NC_007410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]