SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75907930|ref|YP_322226.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75907930|ref|YP_322226.1|
Domain Number 1 Region: 451-549
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 3.92e-27
Family Rad50 coiled-coil Zn hook 0.0049
Further Details:      
 
Domain Number 2 Region: 1-52,786-989
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.51e-21
Family ABC transporter ATPase domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 1-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.87e-20
Family ABC transporter ATPase domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75907930|ref|YP_322226.1|
Sequence length 1008
Comment exonuclease SbcC [Anabaena variabilis ATCC 29413]
Sequence
MIPVQLVLKNFLSYRDATLDFRGLHTACICGANGAGKSSLLEAITWALWGESRAAVEDDV
INSGEKEVRVDFTFQNNQQKYRVIRSRIRGASGILEFQIETPSGFRAITGKGVRATQDLI
LEHIKLDYETFINSAYLRQGRADEFMLKRPSERKEILAELLKLNQYDELEERAKDSSRQF
KVRAEELERSLESIKTQLQQRENTKAQRAELEAEINQLQQVQAFETIQLQSLQVIQHQRQ
NSEQQLNFVRQQYQNLTQDSDRLQQEQSAVKTQLAELEAILHREAEIQNGYSHYQSLQSQ
EEVFAVKFDEHTRATALRQQKQQQLTKQIHELERQLQQVQGQLEALKQQEQEIQHTLSKS
GEIEAALAQLAAARRHLAHLDELQMQVSPLLQQRQHLQSHLDRVHAGLVARLEQLQATEN
QLQRASQRQPQLQQAVMEVAMQIDQMEKDRVYLQRVQEKGHERRNFIERLQAQQREYERL
LGEMEQKLQMLRTPDAICPLCERPLDEHHWNRVVDKTKDEYKETEGQLWVFREQMAVSDR
EIQVLRQEYREISQKLNAYDALREQRGQLAAQLQSTSDAEQQLQQLAAEKQHLERSLQVG
DFALDQQAELRQLEQYLQQLNYNEQDHALARSEVERWRWAEIKQGQIKDASKRLATLAAR
KPELQAQITQLQTRIQQEQTDSEDAQQIAALEEQIAELGYSSEQHNNLRLAVRQSQAWQL
RYQQLLSAQQQYPQLQGRLQDLEVSKLARLQERQQLATQIDSLVEQLAQAANPREQIQAL
EQQLATRRRQLDEQITQLGRLEQLAHQLETLQTQYEEQQQQYQTCKQQYRVYQELAQAFG
KNGIQALMIENVLPQLEAETNQLLSRLSANQLHVQFITQRAGKGSKSTKKNAKLIDTLDI
LIADARGTRAYETYSGGEAFRINFAIRLALAKLLAQRAGAALQLLIVDEGFGTQDAEGCD
RLIAAINAIANDFACILTVTHMPHLKEAFQARIEVDKTQQGSRIRLLT
Download sequence
Identical sequences A0A1W5CCC8 Q3MCF5
240292.Ava_1709 gi|75907930|ref|YP_322226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]