SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|75908291|ref|YP_322587.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75908291|ref|YP_322587.1|
Domain Number 1 Region: 18-121
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-25
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75908291|ref|YP_322587.1|
Sequence length 133
Comment anti-sigma-factor antagonist domain-containing protein [Anabaena variabilis ATCC 29413]
Sequence
MSFLAFVELAIYLVKFMTLTQEPQVVLFKPQGSIDLQGGLALTEQMTQAGSQPHQLWVLD
LAEVDFMDSSGLVSLVKGLTSARQLGCRLILCNVQTPVRLILELTQLDSVFEIFDSYEEI
LTLVNDSSFALVS
Download sequence
Identical sequences A0A1W5CHC7 Q3MBE4
240292.Ava_2070 gi|75908291|ref|YP_322587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]