SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118467604|ref|YP_886072.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118467604|ref|YP_886072.1|
Domain Number 1 Region: 16-136
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.56e-25
Family MarR-like transcriptional regulators 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118467604|ref|YP_886072.1|
Sequence length 158
Comment MarR family transcriptional regulator [Mycobacterium smegmatis str. MC2 155]
Sequence
MADVTPLRAATGTSAATELREAMMAVTRQMRRHRPDHGLTLSQLEILGEVHRSGTITPAE
LGVRLHVRTQSLTDSINELVTRGLIERRPDETDRRRQLISLTQAGAQLLEADRAERDAWL
HDTMRENLSELEFNLLMLVAPVLRKLAYADAAAGTLGS
Download sequence
Identical sequences A0A0D6HDI4 A0QT34 I7FH09 L8FGQ6
gi|118467604|ref|YP_886072.1| WP_003893095.1.100356 WP_003893095.1.19768 WP_003893095.1.23286 WP_003893095.1.56412 WP_003893095.1.74845 WP_003893095.1.94974 WP_003893095.1.96786 YP_886072.1.77314 gi|118467604|ref|YP_886072.1| 246196.MSMEG_1696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]