SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118467907|ref|YP_886875.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118467907|ref|YP_886875.1|
Domain Number 1 Region: 10-139
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.26e-26
Family MarR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118467907|ref|YP_886875.1|
Sequence length 142
Comment MarR family transcriptional regulator [Mycobacterium smegmatis str. MC2 155]
Sequence
MLDMGDILEVQPLGFLMYRVMAVLQPAVAAQLQQLGLTLPEFVCLRILSAQPRQSNAELA
RHINVSPQAMNNVVRALQEKGAVRRPEAASSGRALPAELTTEGAKLLKRAEAAALAAEEE
ALANLTEAQRRELKRLLAHAVD
Download sequence
Identical sequences A0QVD7
gi|118467907|ref|YP_886875.1| WP_011728417.1.100356 WP_011728417.1.19768 WP_011728417.1.23286 WP_011728417.1.56412 WP_011728417.1.74845 YP_886875.1.77314 gi|118467907|ref|YP_886875.1| 246196.MSMEG_2538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]