SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118469066|ref|YP_885874.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118469066|ref|YP_885874.1|
Domain Number 1 Region: 38-169
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.51e-25
Family MarR-like transcriptional regulators 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118469066|ref|YP_885874.1|
Sequence length 173
Comment MarR family transcriptional regulator [Mycobacterium smegmatis str. MC2 155]
Sequence
MPSSPDSFDHADHTDPIALARANWEAAGWGDVADGMVAVTSVMRAHQILLARVENALRPY
DLSFSRFELLRLLAFSRSGALPITKASDRLQVHVTSVTHAIRRLEAAGLVERVPHPTDGR
TTLVRITDLGRSTVEDATVTLNKQVFADVGMSDEESRALAASIETLRRNSGDF
Download sequence
Identical sequences A0A0D6H9I2 A0QSI6 I7G5R6 L8FHD6
gi|118469066|ref|YP_885874.1| WP_003892879.1.100356 WP_003892879.1.19768 WP_003892879.1.23286 WP_003892879.1.56412 WP_003892879.1.74845 WP_003892879.1.94974 WP_003892879.1.96786 YP_885874.1.77314 gi|118469066|ref|YP_885874.1| 246196.MSMEG_1492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]