SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161486588|ref|NP_935959.2| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161486588|ref|NP_935959.2|
Domain Number 1 Region: 6-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.86e-60
Family G proteins 0.0000000305
Further Details:      
 
Domain Number 2 Region: 298-393
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.19e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000316
Further Details:      
 
Domain Number 3 Region: 205-301
Classification Level Classification E-value
Superfamily Translation proteins 5.11e-30
Family Elongation factors 0.00000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161486588|ref|NP_935959.2|
Sequence length 394
Comment elongation factor Tu [Vibrio vulnificus YJ016]
Sequence
MSKEKFERVKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGAARDFASIDNAPEERERG
ITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPVIQGSALGALN
GEEQWEAKIIELAEALDTYIPEPERAIDLPFLMPIEDVFSIQGRGTVVTGRIERGILKVG
DEVAIVGIKDTTTTTCTGVEMFRKLLDEGRAGENVGALLRGTKRDEVERGQVLAKPGSIT
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDISLPEGVEMVMPGDNIQMV
VELISPIAMDEGLRFAIREGGRTVGAGVVAKIFE
Download sequence
Identical sequences A0A1W6M7R2 Q7MGR1 Q8DD27
gi|320155003|ref|YP_004187382.1| 196600.VV3166 gi|326423809|ref|NP_760136.2| gi|161486588|ref|NP_935959.2| WP_011079194.1.100126 WP_011079194.1.16238 WP_011079194.1.17874 WP_011079194.1.25536 WP_011079194.1.28215 WP_011079194.1.28571 WP_011079194.1.34622 WP_011079194.1.49981 WP_011079194.1.53782 WP_011079194.1.54486 WP_011079194.1.54858 WP_011079194.1.63462 WP_011079194.1.67868 WP_011079194.1.73066 WP_011079194.1.78369 WP_011079194.1.90288 WP_011079194.1.93668 WP_011079194.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]