SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161486596|ref|NP_935781.2| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161486596|ref|NP_935781.2|
Domain Number 1 Region: 4-357
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 3.53e-119
Family Dehydroquinate synthase, DHQS 0.00000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161486596|ref|NP_935781.2|
Sequence length 363
Comment 3-dehydroquinate synthase [Vibrio vulnificus YJ016]
Sequence
MERITVNLAERSYPITIGAGLFEDSAHLSSLTAGQKVVVITNVTVAPLYADKILSLLQSL
GCQASLLELPDGEQYKSLDTFNQVMSFLLEGSFARDVVVIALGGGVIGDLVGFSAACYQR
GVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKSVIIDTNCLKTLPEREFAA
GIAEVIKYGIIYDAEFFTWLDEHLDALYSLDEQALTYAIARCCEIKAEVVAQDEKESGIR
ALLNLGHTFGHAIEAELGYGNWLHGEAVAAGTVMAARTAQLQGMIDQQQFDKIFSILSRA
KLPVHTPESMTFDDFMTHMMRDKKVLSGKLRLVLPSSIGTAEVVADVPQEVIRQAIEDCR
TIN
Download sequence
Identical sequences A0A087IG07 A0A0H0XUD4 Q8DCM0
gi|320155171|ref|YP_004187550.1| gi|161486596|ref|NP_935781.2| 196600.VV2988 216895.VV1_1383 gi|27364777|ref|NP_760305.1| WP_011079358.1.13374 WP_011079358.1.16238 WP_011079358.1.17874 WP_011079358.1.21633 WP_011079358.1.22778 WP_011079358.1.24453 WP_011079358.1.25536 WP_011079358.1.31968 WP_011079358.1.33883 WP_011079358.1.34622 WP_011079358.1.39407 WP_011079358.1.43691 WP_011079358.1.49981 WP_011079358.1.53782 WP_011079358.1.54603 WP_011079358.1.553 WP_011079358.1.58885 WP_011079358.1.60868 WP_011079358.1.61535 WP_011079358.1.63462 WP_011079358.1.63825 WP_011079358.1.65015 WP_011079358.1.66219 WP_011079358.1.66581 WP_011079358.1.73066 WP_011079358.1.78668 WP_011079358.1.79678 WP_011079358.1.81460 WP_011079358.1.8379 WP_011079358.1.84562 WP_011079358.1.86005 WP_011079358.1.86748 WP_011079358.1.93668 WP_011079358.1.95941 WP_011079358.1.9921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]