SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161486609|ref|NP_935419.2| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161486609|ref|NP_935419.2|
Domain Number 1 Region: 11-268,320-330
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.14e-33
Family FAD-linked reductases, N-terminal domain 0.09
Further Details:      
 
Domain Number 2 Region: 234-327
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000314
Family D-aminoacid oxidase-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161486609|ref|NP_935419.2|
Sequence length 513
Comment glycerol-3-phosphate dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MKNNSSTPTSTLDILVVGGGINGAGIAADAAGRGLSVALFEAKDFASATSSASSKLIHGG
LRYLEHYEFRLVSEALAEREVLIKKAPHIAFPMRFRLPHRSYLRPAWMIRCGLFLYDHLG
KRTTLPSSHKVNLAETGLLKEEMKIGFEYSDCWVDDARLTLLNAISAKRNGAEVRNYCKV
SKAERVDGLWKVTIEDQQNGEQFVRYAKALVNAAGPWVKQFYDDSLDGPSPRNIRLIKGS
HIVVPRVHPDPQAYILQNNDGRIVFVIPYLDKFSIVGTTDVEYTGDPRHVAISEQEVDYL
IDIVNQHFVHQLSKQDVVWTYSGVRPLCDDESDSPQAITRDYTIELEQELDQAPLLSIFG
GKLTTYRKLAESAMRKLAPYFDHMGTPWTAQQTLPGGDFSCTREQLAHALRQQYPWLSAT
LAYRYVCQYGSDARQLLAGAEEVSAMGIELAPEVYQRELDYLMAHEFAQCSEDILWRRTK
LGLYLTPEQVQSVENYIAKKHTTAQSPQLQQAS
Download sequence
Identical sequences 196600.VV2626 216895.VV1_1785 gi|27365139|ref|NP_760667.1| WP_011079694.1.17874 WP_011079694.1.33883 WP_011079694.1.34622 gi|161486609|ref|NP_935419.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]