SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161486653|ref|NP_933573.2| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161486653|ref|NP_933573.2|
Domain Number 1 Region: 1-54,107-270,360-406
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-51
Family FAD-linked reductases, N-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 270-360
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.7e-17
Family D-aminoacid oxidase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161486653|ref|NP_933573.2|
Sequence length 417
Comment D-amino acid dehydrogenase small subunit [Vibrio vulnificus YJ016]
Sequence
MKAVVLGSGVVGLMSAWYLQKSGYQVTVVDRQARSAEETSFANAGQISYGYSSPWAAPGI
PQKALRWLMEEHAPLKIKPSLDPQLLKWATQMLANCQLSRYQVNKARMLAIANHSRECLS
QLRQEHDIEYQGRQQGTLQIFRTQKQLIAIEKDIALLEQSGTRYQRMSVDECIKQEPGLA
AVSHKLTGGLYLPDDETGDCYLFCQQMTELAQQQGVTFLFNTNVKKVNAQGNQVVSVSTD
AGELQADVYVVAMGSYSTALLAQLGITIPVYPVKGYSLTVPITDESQAPVSTVMDETYKV
ALTRFDDRIRVAGTAELAGFDPAIPEKRKATISMVVNDLFPHSGDFAKAEFWTGFRPMTP
DGTPLIGKTPLKNLYTNTGHGTLGWTMACGSGHLLSQIITGEQSENQAGLDLFRYAS
Download sequence
Identical sequences Q7MND7
gi|161486653|ref|NP_933573.2| WP_011149612.1.34622 196600.VV0781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]