SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161486685|ref|NP_936575.2| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161486685|ref|NP_936575.2|
Domain Number 1 Region: 9-319
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.79e-38
Family FAD-linked reductases, N-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161486685|ref|NP_936575.2|
Sequence length 547
Comment sn-glycerol-3-phosphate dehydrogenase subunit A [Vibrio vulnificus YJ016]
Sequence
MVSSSHFETEVVIIGGGATGTGIMRDCSLRGISCILLEKDDIASGTSGRNHGLLHSGARY
AVTDSESAKECIQENKILKNIARHCVEQTSGLFITLPEDDLAFQDTFIQQCTLAGIETKR
LTPTQALALEPNVNPALVGAVQVPDGTLDPFRLCASNVLDAKEHGGRIFNHTQVVGLIRQ
GDQVRGVKCLHTLTGQAFDIYAREVINAAGIWGQNICEYADLNIKMFPAKGSLLILDYRI
NNLVINRCRKPSDADILVPGDTISLIGTTSEHIEYDQIDDLHVTENEVDVLLREGAKLAP
IMANTRVLRAYAGVRPLVAVDDDGSGRNISRGIVLLDHAERDGLKGLTTITGGKLMTYRL
MAEWATDVVAKKIGNNKACETHIKPLPGSNEMPKAHKKTASIVKPVYESAVYRHGERAEQ
FLKDDDESQTVICECEMVTKGEIEYAIKQLDVSNLVDLRRRTRLGMGPCQGELCSYRAAS
LFSQYGHLDGTVSAHLLTEFLEERWKGVKPIFWGDALRESEFSYWIYEGLFGASELPTVA
DEENASC
Download sequence
Identical sequences A0A1W6M9U1
gi|161486685|ref|NP_936575.2| 196600.VVA0519 216895.VV2_0010 gi|27366473|ref|NP_762000.1| WP_011081005.1.17874 WP_011081005.1.28571 WP_011081005.1.30871 WP_011081005.1.34622 WP_011081005.1.47396 WP_011081005.1.60167 WP_011081005.1.93668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]