SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229047207|ref|NP_935890.2| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229047207|ref|NP_935890.2|
Domain Number 1 Region: 3-250,361-439
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.13e-74
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000000204
Further Details:      
 
Domain Number 2 Region: 444-582
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 9.03e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000333
Further Details:      
 
Domain Number 3 Region: 227-358
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.74e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229047207|ref|NP_935890.2|
Sequence length 605
Comment fumarate reductase flavoprotein subunit [Vibrio vulnificus YJ016]
Sequence
MQTIITDIAVIGAGGAGLRTAIAAAEANPDLEVALISKVYPMRSHTVAAEGGSAAVIKDE
DSLDNHFNDTVGGGDWLCEQDVVEYFVENATREMIQMEQWGCPWSRKENGEVNVRRFGGM
KVERTWFAADKTGFHMLHTLFQTSMKYSNIKRFDEYFVVDLLVDEGEVQGLIAIHMAEGE
LVTIKAKSVVLATGGAGRVYHCNTNGGIVTGDGMAMAYRHGVPLRDMEFVQYHPTGLPGT
GILMTEGCRGEGGIIVNKNGYRYLQDYGMGPETPVGQPKNKYMELGPRDKVSQAFWHEQQ
KGNTIKHPLGDVVHLDLRHLGEEYLQERLPFICELAKAYVNVDPAKEPIPIRPTVHYTMG
GIETDKQCETRIKGLFAVGECASVGLHGANRLGSNSLAEFVVFGRVAGEQAVKRAAEFKG
WNEASIAAQVKAVEERIAALMNQEGDENWADIRTEMGHTMEAGCGIYRQEDLMQATIDKI
TELKARYKRISIKDKGKVFNTDLLYAIEVGYGLEVAEAMVHSAILRKESRGAHQRLDDGC
TDRDDVNFLKHSLAFFQEDQAPNISYSDVTITKSQPKARLYGEAAEKAAAEEAAKAAEKN
AEEQA
Download sequence
Identical sequences A0A0H0Y4H1 A0A1L9KTP1 A0A1V8MTT6
WP_011151343.1.16238 WP_011151343.1.21633 WP_011151343.1.22778 WP_011151343.1.33883 WP_011151343.1.34622 WP_011151343.1.39524 WP_011151343.1.53345 WP_011151343.1.55006 WP_011151343.1.58885 WP_011151343.1.66581 WP_011151343.1.79678 WP_011151343.1.81460 WP_011151343.1.82587 WP_011151343.1.90288 WP_011151343.1.93668 WP_011151343.1.94371 gi|229047207|ref|NP_935890.2| 196600.VV3097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]