SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229047213|ref|NP_934257.2| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229047213|ref|NP_934257.2|
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 1.01e-109
Family Malic enzyme N-domain 0.000000229
Further Details:      
 
Domain Number 2 Region: 268-559
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.58e-95
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229047213|ref|NP_934257.2|
Sequence length 562
Comment malate dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MNNDKRPLYIPFAGPALLSTPLLNKGSAFSAEERISFNLEGLLPETTETIQEQVERAYMQ
YKAFESDMDKHIYLRNIQDTNETLFYRLVQNHITEMMPIIYTPTVGAACENFSNIYRRGR
GLFVSYANRDRIDDILNNASNHNVKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYTACG
GISPAYTLPIVLDVGTNNPQRLADPMYMGWRHPRITGADYDAFVEEFIQAVQRRWPDALI
QFEDFAQKNAMPLLERYKNRICCFNDDIQGTAAVTVGSLMAACQAAGSKLSEQRITFLGA
GSAGCGIAEAIIAQMVSEGISDKKARSQVFMVDRWGLLQEGMPNLLDFQQRLVQKHSVTA
KWETEANGFSLLDVVKNAKPTVLIGVSGAPGLFTQEVIQEMHKHCPRPIVFPLSNPTSRV
EAVPADIIRWTNGDALVATGSPFDPVIHEGKTYPIVQCNNSYIFPGIGLGVLAVNAKRVT
DEMLMESSRALATCSPLAINGKGALLPPLEEIHTVSKRIAYAVAKKAIEQGVALEIADDA
LQVAIEQHFWQPVYRRYKRTAF
Download sequence
Identical sequences A0A1L9L880 A0A2J9Y1L8 Q7MLG3 Q8D911
gi|27366085|ref|NP_761613.1| WP_011080634.1.16238 WP_011080634.1.17874 WP_011080634.1.21633 WP_011080634.1.22486 WP_011080634.1.22778 WP_011080634.1.25536 WP_011080634.1.33883 WP_011080634.1.34622 WP_011080634.1.53345 WP_011080634.1.54486 WP_011080634.1.55006 WP_011080634.1.73066 WP_011080634.1.73173 WP_011080634.1.81460 WP_011080634.1.8379 WP_011080634.1.90288 WP_011080634.1.94371 WP_011080634.1.99976 gi|320156600|ref|YP_004188979.1| gi|229047213|ref|NP_934257.2| 196600.VV1464 216895.VV1_2801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]