SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229047214|ref|NP_933708.2| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229047214|ref|NP_933708.2|
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.42e-48
Family Predicted metal-dependent hydrolase 0.000000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229047214|ref|NP_933708.2|
Sequence length 154
Comment metalloprotease [Vibrio vulnificus YJ016]
Sequence
MAIELDLQLAVEDQNGLPSAQDFQTWLDKTIPPFQPQAEVTIRIVDSQESHQLNHDYRGK
DKPTNVLSFPFEAPPGMEMDLLGDLVICRQVVEQEAIEQDKPLMAHWAHMVVHGSLHLLG
YDHIEDDEAEEMESLETEIMQGMGFTDPYLAEKE
Download sequence
Identical sequences A0A0H0Y9A3 A0A1L9L6L4 A0A1W6M1W1 Q7MN02
gi|229047214|ref|NP_933708.2| 196600.VV0915 WP_011149714.1.16238 WP_011149714.1.21633 WP_011149714.1.22778 WP_011149714.1.33883 WP_011149714.1.34622 WP_011149714.1.53345 WP_011149714.1.55006 WP_011149714.1.58885 WP_011149714.1.66581 WP_011149714.1.79678 WP_011149714.1.81060 WP_011149714.1.81460 WP_011149714.1.90288 WP_011149714.1.93668 WP_011149714.1.94371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]