SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675690|ref|NP_936086.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675690|ref|NP_936086.1|
Domain Number 1 Region: 36-230
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0000000000000138
Family FGase-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37675690|ref|NP_936086.1|
Sequence length 667
Comment hypothetical protein VVA0030 [Vibrio vulnificus YJ016]
Sequence
MLTSNHNQYALEEMLSMIKRGQPFSGELVEGGCFIKIDEYLPVVCTAIHAGHRLRSDLTN
QCLLSDSERLFEEDPYTDDMIMSQPIVLIGLDSRFEYDLNRAMTLSTYYKSAWDVQVWKK
PLSNQQRNRSHQKHAAFYQLYEALIAKLESLHGMVLVFDVHSYNYKRQQADAPVFNIGTA
QIDMERWQSVVKRFCAELQSIALPNLAATAQVNAVFEGRGYLIAHTNAHFDRTLVLPTEV
KKVFMEEESGTLFPLVLEALQSGLKEAFSQTSAFFQRKFNRRRSVSKADMLSSSIEPAVL
AVDKALYKLANKVETLKYVNPTNLTAERKRFEAAPNRYTPDYRYRQLPIHANEFKHQLYR
LPIETIADPDMRQLYSDMVNNLSEKIDLLTSVGQEAFLYNSLRHYGRPDGVDISNAQFLL
YAQTLDEEHGALFTAQQAQTQMQQAAKGWEMPCKVSLSSSLAARAMVSSNPPTLLLNGKV
TFHDTELRRLIQHELGVHMATTFNAKMQPLQVFRLGLPGDTLTQEGLAIMAEYHSGYLSH
ARLQALAVRVLAVDSLLKEHNFYQTFCFLTDELQLERDDAFIITTRVYRGGGFTKDYVYL
KGFLAMLDLSKQRSLDNLMIGKCSHRYLDLIDELVERGWLTQPRHRIPQHQGDIEPTLAY
LIRSLKH
Download sequence
Identical sequences Q7MGD9
gi|37675690|ref|NP_936086.1| 196600.VVA0030 WP_011151464.1.34622 WP_011151464.1.73173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]