SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675704|ref|NP_936100.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675704|ref|NP_936100.1|
Domain Number 1 Region: 10-235,321-353
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.55e-71
Family Type II chitinase 0.000000405
Further Details:      
 
Domain Number 2 Region: 235-320
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.63e-17
Family Chitinase insertion domain 0.0011
Further Details:      
 
Domain Number 3 Region: 558-615
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000000161
Family Carbohydrate binding domain 0.0044
Further Details:      
 
Domain Number 4 Region: 370-462
Classification Level Classification E-value
Superfamily PKD domain 0.0000000106
Family PKD domain 0.011
Further Details:      
 
Domain Number 5 Region: 470-557
Classification Level Classification E-value
Superfamily PKD domain 0.0000589
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37675704|ref|NP_936100.1|
Sequence length 619
Comment chitinase, partial [Vibrio vulnificus YJ016]
Sequence
MGSVSKELPTSFPQAGHQYSTPIKGNYAMMMALKQRYPDLKIIPSIGGWTLSDPFFDFVD
KKNRDTFVASVKRFLTTWKFYDGVDIDWEFPGGDGAAPNLGDPARDGQAYVDLMRELRTM
LNELEAETGRTYELTSAIGVGHDKIEDVNYADAIQYMDYIFAMTYDFYGGWNNVPGHQTA
LYCGNFMRPGQCDGTGVDENGVPYKGPAYTSDHGIQLLLAQGVPANKLVLGTAMYGRGWE
GVMPSTLRDPNDPMTGTATGKLKGSTTQGVWEDGVIDYKGIKSFMLGPNSTGINGFEYGY
DDQAEAPYVWNRTTGELITFDDHRSVLAKGAYAKSLGLAGLFSWEIDADNGDILNAMHEG
LAGGVVLPPNKKPTANAGADVVVVGPATVTLDGSASKDAEGPIASYTWTQVSGPAVTLTG
ANTASASFDAPEVTAAQQFTFQLTVTDADGASASDTVVVTVNAKDTGPVNTAPVAKVTAP
ATANAGDVVVVDASASTDADNDTLTYTWQLPAGLVAQTNGAQVTFTAAEYTADTSLTFTV
TVSDGQASSVASTTVVVAKKVDNGGTCSNAWDASAVYTGGQQVTHAGKTWEAKWWTTGED
PSKSGQWGVWKEIGPANCN
Download sequence
Identical sequences Q7MGC5
gi|37675704|ref|NP_936100.1| 196600.VVA0044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]