SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675712|ref|NP_936108.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675712|ref|NP_936108.1|
Domain Number 1 Region: 121-451,480-551
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.21e-97
Family Amylase, catalytic domain 0.00000451
Further Details:      
 
Domain Number 2 Region: 16-132
Classification Level Classification E-value
Superfamily E set domains 3.8e-24
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 
Domain Number 3 Region: 565-656
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000511
Family alpha-Amylases, C-terminal beta-sheet domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37675712|ref|NP_936108.1|
Sequence length 670
Comment type II secretory pathway, pullulanase [Vibrio vulnificus YJ016]
Sequence
METELRKITMTTSLARPYPLGATLHDKGCNFAVHSPDCASIRLALFDDNNEFKTFELCEE
YAGIRYTFVENVQHGQKYGYIIDTDNGPLLLSDPYAKALDGPLHYQTPYSAEKSFSMPKC
VVYQDDFDWQGTESPRIPREEMVLFETHVKGLSKLNPEVPPAAQGRYLGLVSDAMLAFYR
QQNINTLQLLPVAACMHEPHLLDMGKVNYWGYNPYLFMVPDPRYADKDAILELKTAIREL
HRNGIQVILDVVYNHTAEGGAGPTVFNLKGLDSRCYFKHGSHFANFTGCGNTVDLTYQPA
LNLVMDTLRYWVSEFKVDGFRFDLAATLGRQGDDYSRDAAFFKAVAQDPVLKETKLIAEP
WDIGPNGYQVGNFPFGWNECNDKLRDITRSFWRGDQGYLKEFATRLMGSRDIYSAANWPY
KLTVNYITYHDGFTMQDLVSYKHKHNEDNGEQNRDGHGDNRSENYGAEGPTENLMIIATR
EKQKRNFMASLLFAFGIPHILTADVLSHSQKGNNNAYCQDNETSWLNWEHSERKHDFRHW
LAQMVENRQRYMVPFIRAFSGPSRNLNRIYWRRVDGVHMEHDDWNRLSAVSLHIGIGEKG
DEMVYLINQTSAPARFTLPDDNQQQWTYICDTNVRNVSPELAQGEVLLSPVSMAILHYHP
QESTPPTAAV
Download sequence
Identical sequences Q7MGB7
gi|37675712|ref|NP_936108.1| WP_011151483.1.34622 196600.VVA0052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]