SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37675738|ref|NP_936134.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37675738|ref|NP_936134.1|
Domain Number 1 Region: 165-594,633-718
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.36e-150
Family Amylase, catalytic domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37675738|ref|NP_936134.1|
Sequence length 726
Comment 4-alpha-glucanotransferase [Vibrio vulnificus YJ016]
Sequence
MKEQTALKKVAEMARLADSYVSAWGDEALVSEETLRRLLNSLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGDPVEVELNLGTSARESEFNWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKDLAWGYHKLYVSRKRRKAPYEMALIITPRACFKQDSLELNKKLWGPSIQLY
TLRTQHNWGIGDFGDLKLLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
LYIDVSSVPEFALSAEAQQKVGSAEFQQRLQKARESHWVNYTEVAELKMSVLPLLFAEFK
TRHLDKNSDRARAFLEFVEEGGDSLVHQAAFDALHAELHAQDSNVWGWPVFPEQYRRFDS
AATQKFIKDNQEKVHLYMYLQWIADGQIKEAQALAEEKGMSVGLYRDLAVGVADSGSETW
ADNGNLVLDASIGAPPDILGPLGQNWGLPPLNPEVLQATGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKEDGGFISPKHYADQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPNEEQLNGLFDDRLKCKQGILDSVRWHGYLPEGIGHDAQYVPMDAHLSEALQLHVA
AGASALLSVQLEDWLQMDNPVNIPGTVDEYPNWRRKLSMNLEEIFSREDVNRIARRLTEV
RAQASK
Download sequence
Identical sequences A0A0H0XZE5 A0A1L9KW76 A0A2J9YH83 Q7MG91
WP_011082140.1.16238 WP_011082140.1.17874 WP_011082140.1.25536 WP_011082140.1.34622 WP_011082140.1.53345 WP_011082140.1.55006 WP_011082140.1.66581 WP_011082140.1.73066 WP_011082140.1.73173 WP_011082140.1.79678 WP_011082140.1.81460 WP_011082140.1.90288 WP_011082140.1.94371 WP_011082140.1.9921 gi|27367628|ref|NP_763155.1| gi|320157904|ref|YP_004190282.1| 196600.VVA0078 216895.VV2_1251 gi|37675738|ref|NP_936134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]